PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.004G219800.1.p
Common NameSb04g026480, SORBIDRAFT_04g026480
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 259aa    MW: 28722 Da    PI: 5.2033
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.004G219800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.62.1e-161461148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          rg+WT+eEd  lv  ++++G  +W++ ++  g+ R++k+c++rw +yl
  Sobic.004G219800.1.p 14 RGPWTPEEDRVLVAHIERHGHSNWRALPKQAGLLRCGKSCRLRWINYL 61
                          89******************************99************97 PP

2Myb_DNA-binding543.8e-1767112148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                           rg++T+eE++ +++++++lG++ W++Ia++++ gRt++++k+ w+++l
  Sobic.004G219800.1.p  67 RGNFTAEEEDAIIQLHQMLGNR-WSAIAARLP-GRTDNEIKNVWHTHL 112
                           89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.5E-25564IPR009057Homeodomain-like
PROSITE profilePS5129416.111961IPR017930Myb domain
SuperFamilySSF466894.03E-3110108IPR009057Homeodomain-like
SMARTSM007175.9E-131363IPR001005SANT/Myb domain
PfamPF002491.8E-141461IPR001005SANT/Myb domain
CDDcd001673.51E-111661No hitNo description
PROSITE profilePS5129425.72362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.8E-2765116IPR009057Homeodomain-like
SMARTSM007172.3E-1566114IPR001005SANT/Myb domain
PfamPF002495.8E-1667112IPR001005SANT/Myb domain
CDDcd001675.67E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MGRAPCCEKM GLKRGPWTPE EDRVLVAHIE RHGHSNWRAL PKQAGLLRCG KSCRLRWINY  60
LRPDIKRGNF TAEEEDAIIQ LHQMLGNRWS AIAARLPGRT DNEIKNVWHT HLKKRLEPTT  120
KPASQAPKRK PKKQQQQPET TAVTALEGPT TGAVVPVSPE QSLSTSTTST TTDYSAASSM  180
ENNADSSTSE EEEEEDYQID DSFWSETLAM TVDSSDDSGM QAAFGGAPSS VTSTNDDDMD  240
FWLKLFMQAG DMQNLPQI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C8e-271211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00375DAPTransfer from AT3G23250Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9734711e-179EU973471.1 Zea mays clone 399373 myb-related protein Myb4 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002454197.10.0hypothetical protein SORBIDRAFT_04g026480
SwissprotQ7XBH41e-100MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLC5XXT40.0C5XXT4_SORBI; Putative uncharacterized protein Sb04g026480
STRINGSb04g026480.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.16e-82myb domain protein 15
Publications ? help Back to Top
  1. H
    The R2R3-MYB transcription factors MYB14 and MYB15 regulate stilbene biosynthesis in Vitis vinifera.
    Plant Cell, 2013. 25(10): p. 4135-49
    [PMID:24151295]